PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00934.1.g00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 420aa    MW: 46384 Da    PI: 11.1133
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00934.1.g00080.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.7e-16119166148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+W +eEd++l+ ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Zmw_sc00934.1.g00080.1.am.mk 119 KGAWNKEEDQRLIAYIKAHGEGSWRSLPKAAGLLRCGKSCRLRWMNYL 166
                                   79******************************99************97 PP

2Myb_DNA-binding54.62.5e-17172216147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg++T+++del+++++++lG++ W++Ia  ++ gRt++++k++w+++
  Zmw_sc00934.1.g00080.1.am.mk 172 RGNFTEDDDELIIKLHALLGNK-WSLIAGQLP-GRTDNEIKNYWNTH 216
                                   89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-22110169IPR009057Homeodomain-like
PROSITE profilePS5129415.94114166IPR017930Myb domain
SMARTSM007177.0E-13118168IPR001005SANT/Myb domain
SuperFamilySSF466891.33E-28118213IPR009057Homeodomain-like
PfamPF002492.5E-14119166IPR001005SANT/Myb domain
CDDcd001672.89E-10121166No hitNo description
PROSITE profilePS5129428.041167221IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.8E-27170221IPR009057Homeodomain-like
SMARTSM007171.5E-16171219IPR001005SANT/Myb domain
PfamPF002491.7E-15172216IPR001005SANT/Myb domain
CDDcd001673.10E-12174217No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MRAVKCRAPP PWGRVNQARK KSREGKGPNP PVFPPRTRLA PIYTRTFPAS LHLSFPCCDN  60
QLHQRCSGIG LQANSARRSK EDSSAKEQRK HLRCAGGEAR RRRPIMGRSP CCEKAHTNKG  120
AWNKEEDQRL IAYIKAHGEG SWRSLPKAAG LLRCGKSCRL RWMNYLRPDL KRGNFTEDDD  180
ELIIKLHALL GNKWSLIAGQ LPGRTDNEIK NYWNTHIKRK LLSRGIDPQT HRPXXXXATA  240
ASRPRRRRPG SRRARQSSTS RPMSAAPSED GQSSSGGSTD APRCPDLNLD LDLSVGPPCS  300
PPKTPSATAS TPTSQPQPQQ QRTHICLCYH LGVRGGEACT CKTASPPAFS KMISSLTHPY  360
LDTWVASASR PLAATTISIA VTAAVWTERG RARAPRLIVA LFHALYASLV TSSRIDNFAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-281192217108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456719.11e-136hypothetical protein SORBIDRAFT_03g041360
SwissprotP813931e-90MYB08_ANTMA; Myb-related protein 308
TrEMBLC5XRB41e-136C5XRB4_SORBI; Putative uncharacterized protein Sb03g041360
STRINGSb03g041360.11e-135(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448